SCOP 1.59: Domain d1c30e4: 1c30 E:556-676

Lineage for d1c30e4 (1c30 E:556-676)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)

7. Species Escherichia coli [TaxId:562] [52451] (8 PDB entries)

8. Domain d1c30e4: 1c30 E:556-676 [31670]
   Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c1, d1c30c2, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30e1, d1c30e2, d1c30e5, d1c30e6, d1c30f1, d1c30f2, d1c30g1, d1c30g2, d1c30g5, d1c30g6, d1c30h1, d1c30h2

Details for d1c30e4

PDB Entry: 1c30, 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30e4:

Sequence; same for both SEQRES and ATOM records:

>d1c30e4 c.30.1.1 (E:556-676) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

Timeline for d1c30e4:

• d1c30e4 first appeared (with stable ids) in SCOP 1.55
  
• d1c30e4 appears in SCOP 1.57
  
• d1c30e4 appears in SCOP 1.61
  
• d1c30e4 appears in the current release, SCOPe 2.08