SCOP 1.61: Domain d1a9xg3: 1a9x G:6001-6127

Lineage for d1a9xg3 (1a9x G:6001-6127)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)

7. Species Escherichia coli [TaxId:562] [52451] (9 PDB entries)

8. Domain d1a9xg3: 1a9x G:6001-6127 [31663]
   Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc2, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe2, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg5, d1a9xg6, d1a9xh1, d1a9xh2

Details for d1a9xg3

PDB Entry: 1a9x, 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

SCOP Domain Sequences for d1a9xg3:

Sequence; same for both SEQRES and ATOM records:

>d1a9xg3 c.30.1.1 (G:6001-6127) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

Timeline for d1a9xg3:

• d1a9xg3 first appeared (with stable ids) in SCOP 1.55
  
• d1a9xg3 appears in SCOP 1.59
  
• d1a9xg3 appears in SCOP 1.63
  
• d1a9xg3 appears in the current release, SCOPe 2.08