Lineage for d1a9xd2 (1a9x D:3653-3880)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178184Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 178185Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins)
  6. 178196Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 178197Species Escherichia coli [TaxId:562] [52322] (9 PDB entries)
  8. 178199Domain d1a9xd2: 1a9x D:3653-3880 [31410]
    Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xc1, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xe1, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh1

Details for d1a9xd2

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

SCOP Domain Sequences for d1a9xd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xd2 c.23.16.1 (D:3653-3880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqgnpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1a9xd2:

Click to download the PDB-style file with coordinates for d1a9xd2.
(The format of our PDB-style files is described here.)

Timeline for d1a9xd2:

178199
d1a9xd2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1a9xd1