SCOPe 2.06: Domain d1mjhb_: 1mjh B:

Lineage for d1mjhb_ (1mjh B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
   Pfam PF00582

6. Protein "Hypothetical" protein MJ0577 [52437] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [52438] (1 PDB entry)

8. Domain d1mjhb_: 1mjh B: [31640]
   structural genomics
   complexed with atp, mn

Details for d1mjhb_

PDB Entry: 1mjh, 1.7 Å

PDB Description: structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics

PDB Compounds: (B:) protein (ATP-binding domain of protein mj0577)

SCOPe Domain Sequences for d1mjhb_:

Sequence, based on SEQRES records:

>d1mjhb_ c.26.2.4 (B:) "Hypothetical" protein MJ0577 {Methanococcus jannaschii [TaxId: 2190]}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvagl
nksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvd
iiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns

Sequence, based on observed residues (ATOM records):

>d1mjhb_ c.26.2.4 (B:) "Hypothetical" protein MJ0577 {Methanococcus jannaschii [TaxId: 2190]}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereiksveefenelknklt
eeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeil
lgsvtenvikksnkpvlvvkrkns

Timeline for d1mjhb_:

• d1mjhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mjhb_ appears in SCOPe 2.05
  
• d1mjhb_ appears in SCOPe 2.07
  
• d1mjhb_ appears in the current release, SCOPe 2.08