Lineage for d1dlia3 (1dli A:295-402)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2120339Superfamily c.26.3: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52413] (1 family) (S)
  5. 2120340Family c.26.3.1: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52414] (2 proteins)
  6. 2120355Protein UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain [52415] (1 species)
  7. 2120356Species Streptococcus pyogenes [TaxId:1314] [52416] (2 PDB entries)
  8. 2120358Domain d1dlia3: 1dli A:295-402 [31622]
    Other proteins in same PDB: d1dlia1, d1dlia2
    complexed with gol, nad, so4, udx

Details for d1dlia3

PDB Entry: 1dli (more details), 2.31 Å

PDB Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation
PDB Compounds: (A:) udp-glucose dehydrogenase

SCOPe Domain Sequences for d1dlia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlia3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]}
akqiinvlkeqespvkvvgvyrlimksnsdnfresaikdvidilkskdikiiiyepmlnk
lesedqsvlvndlenfkkqaniivtnrydnelqdvknkvysrdifgrd

SCOPe Domain Coordinates for d1dlia3:

Click to download the PDB-style file with coordinates for d1dlia3.
(The format of our PDB-style files is described here.)

Timeline for d1dlia3: