SCOP 1.59: Domain d1f9af_: 1f9a F:

Lineage for d1f9af_ (1f9a F:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (2 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (2 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [52401] (1 PDB entry)

8. Domain d1f9af_: 1f9a F: [31607]

Details for d1f9af_

PDB Entry: 1f9a, 2 Å

PDB Description: crystal structure analysis of nmn adenylyltransferase from methanococcus jannaschii

SCOP Domain Sequences for d1f9af_:

Sequence; same for both SEQRES and ATOM records:

>d1f9af_ c.26.1.3 (F:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii}
lrgfiigrfqpfhkghlevikkiaeevdeiiigigsaqkshtlenpftagerilmitqsl
kdydltyypipikdiefnsiwvsyvesltppfdivysgnplvrvlfeergyevkrpemfn
rkeysgteirrrmlngekwehlvpkavvdvikeikgverlrkla

Timeline for d1f9af_:

• d1f9af_ first appeared (with stable ids) in SCOP 1.55
  
• d1f9af_ appears in SCOP 1.57
  
• d1f9af_ appears in SCOP 1.61
  
• d1f9af_ appears in the current release, SCOPe 2.08