SCOPe 2.06: Domain d5iaob_: 5iao B:

Lineage for d5iaob_ (5iao B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (13 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [315048] (1 PDB entry)

8. Domain d5iaob_: 5iao B: [315636]
   automated match to d1w30a_
   complexed with urf; mutant

Details for d5iaob_

PDB Entry: 5iao, 2.6 Å

PDB Description: structure and mapping of spontaneous mutational sites of pyrr from mycobacterium tuberculosis

PDB Compounds: (B:) Bifunctional protein PyrR

SCOPe Domain Sequences for d5iaob_:

Sequence, based on SEQRES records:

>d5iaob_ c.61.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
esrelmsaadvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
eysgihvghgalditlyrddlmikpprplastsipaggiddalvilvddvlysgrsvrsa
ldalrdvgrpravqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvi
sr

Sequence, based on observed residues (ATOM records):

>d5iaob_ c.61.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
esrelmsaadvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
eysgihvghgalditlyrdstsipaggiddalvilvddvlysgrsvrsaldalrdvgrpr
avqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvisr

Timeline for d5iaob_:

• d5iaob_ is new in SCOPe 2.06-stable
  
• d5iaob_ appears in SCOPe 2.07
  
• d5iaob_ appears in the current release, SCOPe 2.08