Lineage for d5dbtl_ (5dbt L:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445267Species Streptococcus suis [TaxId:423211] [315210] (2 PDB entries)
  8. 2445279Domain d5dbtl_: 5dbt L: [315410]
    automated match to d1ub3b_

Details for d5dbtl_

PDB Entry: 5dbt (more details), 2.81 Å

PDB Description: crystal structure of c-terminal truncated 2-deoxyribose-5-phosphate aldolase (1-201) from streptococcus suis
PDB Compounds: (L:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d5dbtl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dbtl_ c.1.10.0 (L:) automated matches {Streptococcus suis [TaxId: 423211]}
mklnkyidhtilkpettqeqvekilaeakeydfasvcvnptwvalaaeslkdsdvkvctv
igfplgantpavkafetkdaisngadeidmvinigalktgnydlvledikavvaasgdkl
vkviieaclltddekvkacqlsqeagadyvktstgfstggatvadvalmrktvgpdmgvk
asggarsyedaiafieagasr

SCOPe Domain Coordinates for d5dbtl_:

Click to download the PDB-style file with coordinates for d5dbtl_.
(The format of our PDB-style files is described here.)

Timeline for d5dbtl_: