Class b: All beta proteins [48724] (178 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) |
Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 proteins) |
Protein automated matches [226900] (3 species) not a true protein |
Species Shewanella denitrificans [TaxId:318161] [314879] (3 PDB entries) |
Domain d5i5mb1: 5i5m B:54-498 [315165] Other proteins in same PDB: d5i5ma2, d5i5ma3, d5i5mb2, d5i5mb3 automated match to d1qnia2 complexed with bu3, ca, so4 |
PDB Entry: 5i5m (more details), 1.37 Å
SCOPe Domain Sequences for d5i5mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i5mb1 b.69.3.1 (B:54-498) automated matches {Shewanella denitrificans [TaxId: 318161]} asavvhpgeldeyygfwsgghsgevrilgipsmrelmripvfnidsatgwgitneskrik gdsahlmtgdshhphmsmtdgsyngkyvfindkansrvarircdvmktdkmitipnvqai hglrvqkvpytkyvicngefeipmnndgkasledvstyrslfnvidaekmevafqvmvdg nldntdadydgkyffstcynsemgmnlgemitaerdhvvvfslerclaalkagkftnyng nkvpvldgrkgsdltryipvpksphgintapdgkyfvangklsptvsvveiarlddvfsg kiqprdaivaepelglgplhtafdnkgnafttlfldsqiakwniqdaikayngekvnylr qkldvhyqpghnhtsqgetrdtdgkwlvvlckfskdrflpvgplrpendqlidisgdemk lvhdgptfaephdcmivhrskvkpq
Timeline for d5i5mb1: