Lineage for d5i69a_ (5i69 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2163017Protein automated matches [190140] (30 species)
    not a true protein
  7. 2163094Species Escherichia coli [TaxId:562] [189978] (9 PDB entries)
  8. 2163105Domain d5i69a_: 5i69 A: [315084]
    automated match to d3q28a_
    complexed with mal, so4; mutant

Details for d5i69a_

PDB Entry: 5i69 (more details), 2.7 Å

PDB Description: mbp-mamc magnetite-interaction component mutant-d70a
PDB Compounds: (A:) Maltose-binding periplasmic protein,Tightly bound bacterial magnetic particle protein,Maltose-binding periplasmic protein

SCOPe Domain Sequences for d5i69a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i69a_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdlkekritnteaaiatgk

SCOPe Domain Coordinates for d5i69a_:

Click to download the PDB-style file with coordinates for d5i69a_.
(The format of our PDB-style files is described here.)

Timeline for d5i69a_: