SCOPe 2.08: Domain d5hmca1: 5hmc A:10-133

Lineage for d5hmca1 (5hmc A:10-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Streptomyces sahachiroi [TaxId:285525] [314884] (2 PDB entries)

8. Domain d5hmca1: 5hmc A:10-133 [314885]
   Other proteins in same PDB: d5hmca2
   automated match to d3s4ka_
   complexed with 5ne, so4

Details for d5hmca1

PDB Entry: 5hmc, 2.2 Å

PDB Description: crystal structure of s. sahachiroi azig complexed with 5-methyl naphthoic acid

PDB Compounds: (A:) Azi13

SCOPe Domain Sequences for d5hmca1:

Sequence; same for both SEQRES and ATOM records:

>d5hmca1 d.38.1.0 (A:10-133) automated matches {Streptomyces sahachiroi [TaxId: 285525]}
rlgpyvehlglqferidpdravaywsvradllqphgilhggvhcavvesvasaaadrwlg
drgtvvgvsnstdffapatvadgrltstalpvhrgatqqvwsvetvdaagrlvargqvrl
hnlr

Timeline for d5hmca1:

• d5hmca1 first appeared in SCOPe 2.06
  
• d5hmca1 appears in SCOPe 2.07