Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Streptomyces sahachiroi [TaxId:285525] [314884] (2 PDB entries) |
Domain d5hmca1: 5hmc A:10-133 [314885] Other proteins in same PDB: d5hmca2 automated match to d3s4ka_ complexed with 5ne, so4 |
PDB Entry: 5hmc (more details), 2.2 Å
SCOPe Domain Sequences for d5hmca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hmca1 d.38.1.0 (A:10-133) automated matches {Streptomyces sahachiroi [TaxId: 285525]} rlgpyvehlglqferidpdravaywsvradllqphgilhggvhcavvesvasaaadrwlg drgtvvgvsnstdffapatvadgrltstalpvhrgatqqvwsvetvdaagrlvargqvrl hnlr
Timeline for d5hmca1: