Lineage for d1cs0c2 (1cs0 C:936-1073)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241867Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 241868Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 241869Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 241870Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 241871Species Escherichia coli [TaxId:562] [52338] (9 PDB entries)
  8. 241877Domain d1cs0c2: 1cs0 C:936-1073 [31488]
    Other proteins in same PDB: d1cs0a1, d1cs0a3, d1cs0a4, d1cs0a5, d1cs0a6, d1cs0b1, d1cs0b2, d1cs0c1, d1cs0c3, d1cs0c4, d1cs0c5, d1cs0c6, d1cs0d1, d1cs0d2, d1cs0e1, d1cs0e3, d1cs0e4, d1cs0e5, d1cs0e6, d1cs0f1, d1cs0f2, d1cs0g1, d1cs0g3, d1cs0g4, d1cs0g5, d1cs0g6, d1cs0h1, d1cs0h2

Details for d1cs0c2

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde

SCOP Domain Sequences for d1cs0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs0c2 c.24.1.1 (C:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1cs0c2:

Click to download the PDB-style file with coordinates for d1cs0c2.
(The format of our PDB-style files is described here.)

Timeline for d1cs0c2: