Lineage for d5hw3a1 (5hw3 A:28-291)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245472Species Burkholderia vietnamiensis [TaxId:269482] [314848] (1 PDB entry)
  8. 2245473Domain d5hw3a1: 5hw3 A:28-291 [314849]
    Other proteins in same PDB: d5hw3a2
    automated match to d1hzoa_
    complexed with act, so4

Details for d5hw3a1

PDB Entry: 5hw3 (more details), 1.45 Å

PDB Description: crystal structure of a beta lactamase from burkholderia vietnamiensis
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5hw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hw3a1 e.3.1.0 (A:28-291) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
aaeesplaeierrsggrlgvfaidtgsgrtlghraderflmcstfkgllaaqilarvdsg
serldrlvhytekdliftspvtkanvaqgamsiealcravlvesdntaaillmrsaggpa
altrfvrglgdtvtrsdryepdsnryhgvldtttpkaiaataqrlllgdvlsagsrarle
rgmtdckpglnriraalpagwlaadrpgtsvdretndyalvrppgrapllvavyydapgv
smdareavlreagsafvqwatnag

SCOPe Domain Coordinates for d5hw3a1:

Click to download the PDB-style file with coordinates for d5hw3a1.
(The format of our PDB-style files is described here.)

Timeline for d5hw3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hw3a2