SCOPe 2.06: Domain d5hs3c1: 5hs3 C:26-305

Lineage for d5hs3c1 (5hs3 C:26-305)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55840] (26 PDB entries)

8. Domain d5hs3c1: 5hs3 C:26-305 [314814]
   Other proteins in same PDB: d5hs3a2, d5hs3b2, d5hs3c2, d5hs3d2, d5hs3e2, d5hs3f2
   automated match to d1hvya_
   complexed with ki3, ump

Details for d5hs3c1

PDB Entry: 5hs3, 3.1 Å

PDB Description: human thymidylate synthase complexed with dump and 3-amino-2-benzoyl- 4-methylthieno[2,3-b]pyridin-6-ol

PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d5hs3c1:

Sequence; same for both SEQRES and ATOM records:

>d5hs3c1 d.117.1.1 (C:26-305) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphp

Timeline for d5hs3c1:

• d5hs3c1 is new in SCOPe 2.06-stable
  
• d5hs3c1 appears in SCOPe 2.07
  
• d5hs3c1 appears in the current release, SCOPe 2.08