Lineage for d1fyea_ (1fye A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 984114Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 984426Family c.23.16.4: Aspartyl dipeptidase PepE [52331] (1 protein)
    probable circular permutation in the common core; contains a catalytic Ser-His-Glu triad
  6. 984427Protein Aspartyl dipeptidase PepE [52332] (1 species)
  7. 984428Species Salmonella typhimurium [TaxId:90371] [52333] (2 PDB entries)
  8. 984429Domain d1fyea_: 1fye A: [31477]
    complexed with cd

Details for d1fyea_

PDB Entry: 1fye (more details), 1.2 Å

PDB Description: aspartyl dipeptidase (anisotropic b-factor refinement)
PDB Compounds: (A:) aspartyl dipeptidase

SCOPe Domain Sequences for d1fyea_:

Sequence, based on SEQRES records: (download)

>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]}
mellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlapl
gvnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigws
aganlacptirttndmpivdpngfdaldlfplqinphftnalpeghkgetreqrirellv
vapeltviglpegnwiqvsngqavlggpnttwvfkageeavaleaghrf

Sequence, based on observed residues (ATOM records): (download)

>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]}
mellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlapl
gvnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigws
aganlacptirttndmpivdpngfdaldlfplqinphftntreqrirellvvapeltvig
lpegnwiqvsngqavlggpnttwvfkageeavaleaghrf

SCOPe Domain Coordinates for d1fyea_:

Click to download the PDB-style file with coordinates for d1fyea_.
(The format of our PDB-style files is described here.)

Timeline for d1fyea_: