Lineage for d5fugd_ (5fug D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698749Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)
  8. 2698976Domain d5fugd_: 5fug D: [314583]
    automated match to d1id3c_
    protein/DNA complex

Details for d5fugd_

PDB Entry: 5fug (more details), 2.7 Å

PDB Description: crystal structure of a human yl1-h2a.z-h2b complex
PDB Compounds: (D:) histone h2a.z

SCOPe Domain Sequences for d5fugd_:

Sequence, based on SEQRES records: (download)

>d5fugd_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskdlk
vkritprhlqlairgdeeldslikatiag

Sequence, based on observed residues (ATOM records): (download)

>d5fugd_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srsqraglqfpvgrihrhlksrrvgataavysaaileyltaevlelagnaskdlkvkrit
prhlqlairgdeeldslikatiag

SCOPe Domain Coordinates for d5fugd_:

Click to download the PDB-style file with coordinates for d5fugd_.
(The format of our PDB-style files is described here.)

Timeline for d5fugd_: