Lineage for d5ftjb1 (5ftj B:21-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070519Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2070582Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2070727Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)
  6. 2070728Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)
  7. 2070729Species Human (Homo sapiens) [TaxId:9606] [233316] (12 PDB entries)
  8. 2070740Domain d5ftjb1: 5ftj B:21-106 [314529]
    Other proteins in same PDB: d5ftja2, d5ftja3, d5ftja4, d5ftjb2, d5ftjb3, d5ftjb4, d5ftjc2, d5ftjc3, d5ftjc4, d5ftjd2, d5ftjd3, d5ftjd4, d5ftje2, d5ftje3, d5ftje4, d5ftjf2, d5ftjf3, d5ftjf4
    automated match to d3cf1a1
    complexed with adp, oja

Details for d5ftjb1

PDB Entry: 5ftj (more details), 2.3 Å

PDB Description: cryo-em structure of human p97 bound to upcdc30245 inhibitor
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5ftjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ftjb1 b.52.2.3 (B:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
kirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d5ftjb1:

Click to download the PDB-style file with coordinates for d5ftjb1.
(The format of our PDB-style files is described here.)

Timeline for d5ftjb1: