Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.14: Histone demethylase core [254153] (4 proteins) Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801 |
Protein JMJD2A core [254342] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254775] (41 PDB entries) |
Domain d5f37b_: 5f37 B: [313843] automated match to d4v2wb_ complexed with dms, edo, n5j, zn |
PDB Entry: 5f37 (more details), 2.22 Å
SCOPe Domain Sequences for d5f37b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f37b_ b.82.2.14 (B:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]} masesetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyd diddlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerk ywknltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgm wktsfawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrh kmtlisplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieyg kqavlcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
Timeline for d5f37b_: