Lineage for d5dtzb1 (5dtz B:3-232)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) 
Protein Green fluorescent protein, GFP [54513] (5 species) Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (272 PDB entries)
Uniprot P42212
Domain d5dtzb1: 5dtz B:3-232 [313669]
Other proteins in same PDB: d5dtza2, d5dtzb2, d5dtzc2, d5dtzd2
automated match to d3st3a_
complexed with peg
Details for d5dtzb1
PDB Entry: 5dtz (more details), 1.5 Å
PDB Description: crystal structure of rsfolder in the fluorescent on-state
PDB Compounds: (B:) Green fluorescent proteinSCOPe Domain Sequences for d5dtzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dtzb1 d.22.1.1 (B:3-232) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
ttlxvlcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
elkgidfkedgnilghkleynfnshnvyitadkqkngiksnfkirhnvedgsvqladhyq
qntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagith
SCOPe Domain Coordinates for d5dtzb1:
Click to download the PDB-style file with coordinates for d5dtzb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5dtzb1:
View in 3D
