Lineage for d2nadb2 (2nad B:1-147,B:336-383)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241529Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 241530Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 241548Protein Formate dehydrogenase [52285] (1 species)
    contains an additional beta-hairpin after the common fold
  7. 241549Species Pseudomonas sp., strain 101 [TaxId:306] [52286] (2 PDB entries)
  8. 241553Domain d2nadb2: 2nad B:1-147,B:336-383 [31351]
    Other proteins in same PDB: d2nada1, d2nadb1
    complexed with azi, nad, so4

Details for d2nadb2

PDB Entry: 2nad (more details), 2 Å

PDB Description: high resolution structures of holo and apo formate dehydrogenase

SCOP Domain Sequences for d2nadb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nadb2 c.23.12.1 (B:1-147,B:336-383) Formate dehydrogenase {Pseudomonas sp., strain 101}
akvlcvlyddpvdgypktyarddlpkidhypggqtlptpkaidftpgqllgsvsgelglr
kylesnghtlvvtsdkdgpdsvferelvdadvvisqpfwpayltperiakaknlklalta
gigsdhvdlqsaidrnvtvaevtycnsXttltaqaryaagtreilecffegrpirdeyli
vqggalagtgahsysk

SCOP Domain Coordinates for d2nadb2:

Click to download the PDB-style file with coordinates for d2nadb2.
(The format of our PDB-style files is described here.)

Timeline for d2nadb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nadb1