SCOPe 2.06: Domain d5d7ia1: 5d7i A:1-178

Lineage for d5d7ia1 (5d7i A:1-178)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d5d7ia1: 5d7i A:1-178 [313326]
   Other proteins in same PDB: d5d7ia2, d5d7ib_, d5d7ic2, d5d7id_, d5d7ie1, d5d7ie2, d5d7if1, d5d7if2, d5d7ig1, d5d7ig2, d5d7ih1, d5d7ih2
   automated match to d4l4va1

Details for d5d7ia1

PDB Entry: 5d7i, 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5d7ia1:

Sequence; same for both SEQRES and ATOM records:

>d5d7ia1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d5d7ia1:

• d5d7ia1 is new in SCOPe 2.06-stable
  
• d5d7ia1 appears in SCOPe 2.07
  
• d5d7ia1 appears in the current release, SCOPe 2.08