Lineage for d5d0xq_ (5d0x Q:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600449Domain d5d0xq_: 5d0x Q: [313229]
    Other proteins in same PDB: d5d0xa_, d5d0xe_, d5d0xg_, d5d0xi_, d5d0xj_, d5d0xk_, d5d0xl_, d5d0xn_, d5d0xo_, d5d0xs_, d5d0xu_, d5d0xw_, d5d0xx_, d5d0xy_, d5d0xz_
    automated match to d1rypd_
    complexed with bo2, cl, mg; mutant

Details for d5d0xq_

PDB Entry: 5d0x (more details), 2.6 Å

PDB Description: yeast 20s proteasome beta5-t1s mutant in complex with bortezomib
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5d0xq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d0xq_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5d0xq_:

Click to download the PDB-style file with coordinates for d5d0xq_.
(The format of our PDB-style files is described here.)

Timeline for d5d0xq_: