SCOPe 2.08: Domain d5d0xq1: 5d0x Q:1-234

Lineage for d5d0xq1 (5d0x Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d5d0xq1: 5d0x Q:1-234 [313229]
   Other proteins in same PDB: d5d0xa_, d5d0xc2, d5d0xe_, d5d0xg_, d5d0xi_, d5d0xj_, d5d0xk_, d5d0xl_, d5d0xn_, d5d0xo_, d5d0xq2, d5d0xs_, d5d0xu_, d5d0xw_, d5d0xx_, d5d0xy_, d5d0xz_
   automated match to d1rypd_
   complexed with bo2, cl, mg; mutant

Details for d5d0xq1

PDB Entry: 5d0x, 2.6 Å

PDB Description: yeast 20s proteasome beta5-t1s mutant in complex with bortezomib

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5d0xq1:

Sequence; same for both SEQRES and ATOM records:

>d5d0xq1 d.153.1.4 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d5d0xq1:

• d5d0xq1 first appeared in SCOPe 2.06, called d5d0xq_
  
• d5d0xq1 was called d5d0xq_ in SCOPe 2.07