Lineage for d5cnsb1 (5cns B:4-221)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334298Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 2334299Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 2334300Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 2334301Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 2334302Species Escherichia coli [TaxId:562] [48171] (10 PDB entries)
    Uniprot Q08698
  8. 2334326Domain d5cnsb1: 5cns B:4-221 [312852]
    Other proteins in same PDB: d5cnsa2, d5cnsb2, d5cnsc2, d5cnsd2
    automated match to d2r1ra1
    complexed with cdp, dat, dtp, feo, mg

Details for d5cnsb1

PDB Entry: 5cns (more details), 2.98 Å

PDB Description: crystal structure of the datp inhibited e. coli class ia ribonucleotide reductase complex bound to cdp and datp at 2.97 angstroms resolution
PDB Compounds: (B:) ribonucleoside-diphosphate reductase 1 subunit alpha

SCOPe Domain Sequences for d5cnsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cnsb1 a.98.1.1 (B:4-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
nllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetii
kaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledy
teeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsn
ypretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOPe Domain Coordinates for d5cnsb1:

Click to download the PDB-style file with coordinates for d5cnsb1.
(The format of our PDB-style files is described here.)

Timeline for d5cnsb1: