SCOPe 2.07: Domain d5cnsc1: 5cns C:5-221

Lineage for d5cnsc1 (5cns C:5-221)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)

7. Species Escherichia coli [TaxId:562] [48171] (10 PDB entries)
   Uniprot Q08698

8. Domain d5cnsc1: 5cns C:5-221 [312820]
   Other proteins in same PDB: d5cnsa2, d5cnsb2, d5cnsc2, d5cnsd2
   automated match to d2r1ra1
   complexed with cdp, dat, dtp, feo, mg

Details for d5cnsc1

PDB Entry: 5cns, 2.98 Å

PDB Description: crystal structure of the datp inhibited e. coli class ia ribonucleotide reductase complex bound to cdp and datp at 2.97 angstroms resolution

PDB Compounds: (C:) ribonucleoside-diphosphate reductase 1 subunit alpha

SCOPe Domain Sequences for d5cnsc1:

Sequence; same for both SEQRES and ATOM records:

>d5cnsc1 a.98.1.1 (C:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d5cnsc1:

• d5cnsc1 first appeared in SCOPe 2.06
  
• d5cnsc1 appears in the current release, SCOPe 2.08