Class a: All alpha proteins [46456] (289 folds) |
Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) |
Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
Species Escherichia coli [TaxId:562] [48171] (10 PDB entries) Uniprot Q08698 |
Domain d5cnsc1: 5cns C:5-221 [312820] Other proteins in same PDB: d5cnsa2, d5cnsb2, d5cnsc2, d5cnsd2 automated match to d2r1ra1 complexed with cdp, dat, dtp, feo, mg |
PDB Entry: 5cns (more details), 2.98 Å
SCOPe Domain Sequences for d5cnsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cnsc1 a.98.1.1 (C:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]} llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny pretrlqyvkrfydavstfkislptpimsgvrtptrq
Timeline for d5cnsc1: