Lineage for d1ordb1 (1ord B:1-107)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68476Superfamily c.23.7: Ornithine decarboxylase N-terminal "wing" domain [52251] (1 family) (S)
  5. 68477Family c.23.7.1: Ornithine decarboxylase N-terminal "wing" domain [52252] (1 protein)
  6. 68478Protein Ornithine decarboxylase N-terminal "wing" domain [52253] (1 species)
  7. 68479Species Lactobacillus sp., strain 30a [TaxId:1591] [52254] (2 PDB entries)
  8. 68482Domain d1ordb1: 1ord B:1-107 [31275]
    Other proteins in same PDB: d1orda2, d1orda3, d1ordb2, d1ordb3

Details for d1ordb1

PDB Entry: 1ord (more details), 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution

SCOP Domain Sequences for d1ordb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ordb1 c.23.7.1 (B:1-107) Ornithine decarboxylase N-terminal "wing" domain {Lactobacillus sp., strain 30a}
ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsil

SCOP Domain Coordinates for d1ordb1:

Click to download the PDB-style file with coordinates for d1ordb1.
(The format of our PDB-style files is described here.)

Timeline for d1ordb1: