SCOPe 2.06: Domain d5cgwa1: 5cgw A:3-361

Lineage for d5cgwa1 (5cgw A:3-361)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225496] (14 PDB entries)

8. Domain d5cgwa1: 5cgw A:3-361 [312737]
   Other proteins in same PDB: d5cgwa2
   automated match to d2wzxa_
   complexed with act, zn; mutant

Details for d5cgwa1

PDB Entry: 5cgw, 1.4 Å

PDB Description: crystal structure of fox-4 cephamycinase mutant y150f

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5cgwa1:

Sequence; same for both SEQRES and ATOM records:

>d5cgwa1 e.3.1.0 (A:3-361) automated matches {Escherichia coli [TaxId: 562]}
sgeapltatvdgiiqpmlkayripgmavavlkdgkahyfnygvanresgqrvseqtlfei
gsvsktltatlgayaavkggfelddkvsqhapwlkgsafdgvtmaelatysagglplqfp
devdsndkmqtyyrswspvypagthrqfsnpsiglfghlaanslgqpfeqlmsqtllpkl
glhhtyiqvpesamanyaygyskedkpiratpgvlaaeaygiktgsadllkfveanmgyq
gdaalksaialthtgfhsvgemtqglgwesydypvteqvllagnspavsfqanpvtrfav
pkamgeqrlynktgstggfgayvafvpargiaivmlanrnypiearvkaahailsqlae

Timeline for d5cgwa1:

• d5cgwa1 is new in SCOPe 2.06-stable
  
• d5cgwa1 appears in SCOPe 2.07
  
• d5cgwa1 appears in the current release, SCOPe 2.08