Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (16 species) not a true protein |
Species Bdellovibrio bacteriovorus [TaxId:264462] [312720] (3 PDB entries) |
Domain d5c7qb_: 5c7q B: [312721] automated match to d1vhzb_ complexed with gol, peg, pg0, pge, so4 |
PDB Entry: 5c7q (more details), 1.52 Å
SCOPe Domain Sequences for d5c7qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c7qb_ d.113.1.0 (B:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]} hleektlstrqifkgrylkieqdqvqapdgrtytreyilhpgaammipllpngnvvmihq yrhavkkvflefpagkrdhneetlltakrelleetgyeakdwkflttihpvigysnehid lylardlthleqrldqgefievvevkpadlmqlvlegkvsdvktqigafwldkflrgewn
Timeline for d5c7qb_: