Lineage for d5c7qb_ (5c7q B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211807Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2211808Protein automated matches [191036] (16 species)
    not a true protein
  7. 2211826Species Bdellovibrio bacteriovorus [TaxId:264462] [312720] (3 PDB entries)
  8. 2211828Domain d5c7qb_: 5c7q B: [312721]
    automated match to d1vhzb_
    complexed with gol, peg, pg0, pge, so4

Details for d5c7qb_

PDB Entry: 5c7q (more details), 1.52 Å

PDB Description: crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase
PDB Compounds: (B:) NudF protein

SCOPe Domain Sequences for d5c7qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c7qb_ d.113.1.0 (B:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]}
hleektlstrqifkgrylkieqdqvqapdgrtytreyilhpgaammipllpngnvvmihq
yrhavkkvflefpagkrdhneetlltakrelleetgyeakdwkflttihpvigysnehid
lylardlthleqrldqgefievvevkpadlmqlvlegkvsdvktqigafwldkflrgewn

SCOPe Domain Coordinates for d5c7qb_:

Click to download the PDB-style file with coordinates for d5c7qb_.
(The format of our PDB-style files is described here.)

Timeline for d5c7qb_: