Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (40 species) not a true protein |
Species Yersinia pestis [TaxId:632] [280582] (5 PDB entries) |
Domain d5bphd1: 5bph D:1-96 [312615] Other proteins in same PDB: d5bpha2, d5bphb2, d5bphc2, d5bphd2 automated match to d1iowa1 complexed with act, amp, gol, na |
PDB Entry: 5bph (more details), 1.7 Å
SCOPe Domain Sequences for d5bphd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bphd1 c.30.1.0 (D:1-96) automated matches {Yersinia pestis [TaxId: 632]} maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi alhgrggedgtlqgvleflqlpytgsgvmasaltmd
Timeline for d5bphd1: