Lineage for d5b0fa_ (5b0f A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193227Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2193599Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2193600Protein automated matches [190081] (27 species)
    not a true protein
  7. 2193646Species Cannabis sativa [TaxId:3483] [312528] (9 PDB entries)
  8. 2193652Domain d5b0fa_: 5b0f A: [312552]
    automated match to d1q4ra_
    complexed with gol; mutant

Details for d5b0fa_

PDB Entry: 5b0f (more details), 1.6 Å

PDB Description: polyketide cyclase oac from cannabis sativa, y72f mutant
PDB Compounds: (A:) Olivetolic acid cyclase

SCOPe Domain Sequences for d5b0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b0fa_ d.58.4.0 (A:) automated matches {Cannabis sativa [TaxId: 3483]}
avkhlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegythivev
tfesvetiqdfiihpahvgfgdvyrsfwekllifdytprk

SCOPe Domain Coordinates for d5b0fa_:

Click to download the PDB-style file with coordinates for d5b0fa_.
(The format of our PDB-style files is described here.)

Timeline for d5b0fa_: