SCOPe 2.06: Domain d4yyya3: 4yyy A:336-440

Lineage for d4yyya3 (4yyy A:336-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families)

5. Family d.41.3.0: automated matches [254277] (1 protein)
   not a true family

6. Protein automated matches [254643] (5 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [311467] (3 PDB entries)

8. Domain d4yyya3: 4yyy A:336-440 [312282]
   Other proteins in same PDB: d4yyya1, d4yyya2, d4yyyb1, d4yyyb2
   automated match to d4x46b3
   complexed with cit, pge, uri

Details for d4yyya3

PDB Entry: 4yyy, 2.43 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with uridine

PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4yyya3:

Sequence; same for both SEQRES and ATOM records:

>d4yyya3 d.41.3.0 (A:336-440) automated matches {Salmonella typhimurium [TaxId: 99287]}
tamlskavyadtegfisamdtralgmavvsmgggrrqasdtidysvgftdmarlgdsidg
qrplavihakdeaswqeaakavkaaiilddkapastpsvyrrite

Timeline for d4yyya3:

• d4yyya3 is new in SCOPe 2.06-stable
  
• d4yyya3 appears in SCOPe 2.07
  
• d4yyya3 appears in the current release, SCOPe 2.08