Lineage for d4ypoa2 (4ypo A:181-325)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721846Species Mycobacterium tuberculosis [TaxId:1773] [312097] (1 PDB entry)
  8. 2721847Domain d4ypoa2: 4ypo A:181-325 [312098]
    Other proteins in same PDB: d4ypoa1, d4ypob1
    automated match to d4kqxb2
    complexed with cl, mg, na

Details for d4ypoa2

PDB Entry: 4ypo (more details), 1 Å

PDB Description: crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+
PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4ypoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ypoa2 a.100.1.0 (A:181-325) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
fkdetetdlfgeqtvlcggteelvkagfevmveagypaelayfevlhelklivdlmyegg
larmyysvsdtaefggylsgprvidagtkermrdilreiqdgsfvhklvadveggnkqle
elrrqnaehpievvgkklrdlmswv

SCOPe Domain Coordinates for d4ypoa2:

Click to download the PDB-style file with coordinates for d4ypoa2.
(The format of our PDB-style files is described here.)

Timeline for d4ypoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ypoa1