Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
Protein Flavodoxin [52220] (10 species) |
Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries) |
Domain d1ftga_: 1ftg A: [31176] apo form complexed with so4 |
PDB Entry: 1ftg (more details), 2 Å
SCOPe Domain Sequences for d1ftga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftga_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
Timeline for d1ftga_: