SCOPe 2.06: Domain d1dx9b_: 1dx9 B:

Lineage for d1dx9b_ (1dx9 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (10 species)

7. Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries)

8. Domain d1dx9b_: 1dx9 B: [31172]
   apo form
   complexed with so4

Details for d1dx9b_

PDB Entry: 1dx9, 2.05 Å

PDB Description: w57a apoflavodoxin from anabaena

PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d1dx9b_:

Sequence; same for both SEQRES and ATOM records:

>d1dx9b_ c.23.5.1 (B:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

Timeline for d1dx9b_:

• d1dx9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1dx9b_ appears in SCOPe 2.05
  
• d1dx9b_ appears in SCOPe 2.07
  
• d1dx9b_ appears in the current release, SCOPe 2.08