Lineage for d4xoag2 (4xoa G:159-279)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377244Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2377265Protein Mannose-specific adhesin FimH [49406] (2 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2377354Species Escherichia coli [TaxId:83333] [273015] (19 PDB entries)
  8. 2377395Domain d4xoag2: 4xoa G:159-279 [311714]
    automated match to d1klfb2

Details for d4xoag2

PDB Entry: 4xoa (more details), 2.54 Å

PDB Description: crystal structure of a fimh*dsg complex from e.coli k12 in space group p1
PDB Compounds: (G:) protein fimh

SCOPe Domain Sequences for d4xoag2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xoag2 b.2.3.2 (G:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 83333]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d4xoag2:

Click to download the PDB-style file with coordinates for d4xoag2.
(The format of our PDB-style files is described here.)

Timeline for d4xoag2: