Lineage for d4xoaa2 (4xoa A:159-279)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like foldSuperfamily b.2.3: Bacterial adhesins [49401] (7 families) 
Family b.2.3.2: Pilus subunits [49405] (10 proteins) 
Protein Mannose-specific adhesin FimH [49406] (2 species)
duplication: consists of two domains of this fold; C-terminal domain lacks the last strandSpecies Escherichia coli [TaxId:83333] [273015] (19 PDB entries) 
Domain d4xoaa2: 4xoa A:159-279 [311652]
automated match to d1klfb2
Details for d4xoaa2
PDB Entry: 4xoa (more details), 2.54 Å
PDB Description: crystal structure of a fimh*dsg complex from e.coli k12 in space group p1
PDB Compounds: (A:) protein fimhSCOPe Domain Sequences for d4xoaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xoaa2 b.2.3.2 (A:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 83333]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q
SCOPe Domain Coordinates for d4xoaa2:
Click to download the PDB-style file with coordinates for d4xoaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4xoaa2:
View in 3D
