Lineage for d1fx1__ (1fx1 -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120383Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 120384Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
  6. 120385Protein Flavodoxin [52220] (7 species)
  7. 120425Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries)
  8. 120448Domain d1fx1__: 1fx1 - [31169]

Details for d1fx1__

PDB Entry: 1fx1 (more details), 2 Å

PDB Description: a crystallographic structural study of the oxidation states of desulfovibrio vulgaris flavodoxin

SCOP Domain Sequences for d1fx1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx1__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris}
pkalivygsttgnteytaetiarqlanagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOP Domain Coordinates for d1fx1__:

Click to download the PDB-style file with coordinates for d1fx1__.
(The format of our PDB-style files is described here.)

Timeline for d1fx1__: