Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
Superfamily c.23.5: Flavoproteins [52218] (3 families) |
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) |
Protein Flavodoxin [52220] (6 species) |
Species Desulfovibrio vulgaris [TaxId:881] [52222] (15 PDB entries) |
Domain d1fx1__: 1fx1 - [31169] |
PDB Entry: 1fx1 (more details), 2 Å
SCOP Domain Sequences for d1fx1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx1__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris} pkalivygsttgnteytaetiarqlanagyevdsrdaasveagglfegfdlvllgcstwg ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq dglridgdpraarddivgwahdvrgai
Timeline for d1fx1__: