Lineage for d1fx1__ (1fx1 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) 
Species Desulfovibrio vulgaris [TaxId:881] [52222] (15 PDB entries) 
Domain d1fx1__: 1fx1 - [31169]
Details for d1fx1__
PDB Entry: 1fx1 (more details), 2 Å
PDB Description: a crystallographic structural study of the oxidation states of desulfovibrio vulgaris flavodoxin
SCOP Domain Sequences for d1fx1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx1__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris}
pkalivygsttgnteytaetiarqlanagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai
SCOP Domain Coordinates for d1fx1__:
Click to download the PDB-style file with coordinates for d1fx1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fx1__:
- d1fx1__ appears in SCOP 1.57
- d1fx1__ appears in the current release, SCOPe 2.08, called d1fx1a_
View in 3D