PDB entry 1fx1

View 1fx1 on RCSB PDB site
Description: a crystallographic structural study of the oxidation states of desulfovibrio vulgaris flavodoxin
Deposited on 1984-10-15, released 1985-01-02
The last revision prior to the SCOP 1.55 freeze date was dated 1985-01-02, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1fx1__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fx1_ (-)
pkalivygsttgnteytaetiarqlanagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai