SCOPe 2.08: Domain d4xqrf_: 4xqr F:

Lineage for d4xqrf_ (4xqr F:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (85 PDB entries)

8. Domain d4xqrf_: 4xqr F: [311678]
   automated match to d4demf_
   complexed with po4

Details for d4xqrf_

PDB Entry: 4xqr, 2.15 Å

PDB Description: crystal structure of unliganded human fpps at 2.15 angstrom resolution

PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4xqrf_:

Sequence; same for both SEQRES and ATOM records:

>d4xqrf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvvaf
relveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvglda
indanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrf
tekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldl
fgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeel
dlpavflqyeedsyshimalieqyaaplppavflglarkiy

Timeline for d4xqrf_:

• d4xqrf_ first appeared in SCOPe 2.06
  
• d4xqrf_ appears in SCOPe 2.07