Lineage for d2n9ia_ (2n9i A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304491Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2304691Species Human (Homo sapiens) [TaxId:9606] [109644] (12 PDB entries)
    Uniprot P99999
  8. 2304722Domain d2n9ia_: 2n9i A: [311650]
    automated match to d3zcfa_
    complexed with hec

Details for d2n9ia_

PDB Entry: 2n9i (more details)

PDB Description: solution structure of reduced human cytochrome c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d2n9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n9ia_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d2n9ia_:

Click to download the PDB-style file with coordinates for d2n9ia_.
(The format of our PDB-style files is described here.)

Timeline for d2n9ia_: