PDB entry 2n9i

View 2n9i on RCSB PDB site
Description: Solution structure of reduced human cytochrome c
Class: electron transport
Keywords: cytochrome c, electron transfer, ELECTRON TRANSPORT
Deposited on 2015-11-24, released 2016-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2n9ia_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n9iA (A:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne