SCOPe 2.06: Domain d4xe6x1: 4xe6 X:1-156

Lineage for d4xe6x1 (4xe6 X:1-156)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Staphylococcus aureus [TaxId:1280] [188976] (25 PDB entries)

8. Domain d4xe6x1: 4xe6 X:1-156 [311612]
   Other proteins in same PDB: d4xe6x2
   automated match to d3fywx_
   complexed with 06u, act, ndp

Details for d4xe6x1

PDB Entry: 4xe6, 2.69 Å

PDB Description: staphylococcus aureus dihydrofolate reductase complexed with nadph and 6-ethyl-5-[(3r)-3-[3-methoxy-5-(pyridin-4-yl)phenyl]but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp1061)

PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d4xe6x1:

Sequence; same for both SEQRES and ATOM records:

>d4xe6x1 c.71.1.1 (X:1-156) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlir

Timeline for d4xe6x1:

• d4xe6x1 is new in SCOPe 2.06-stable
  
• d4xe6x1 appears in SCOPe 2.07
  
• d4xe6x1 appears in the current release, SCOPe 2.08