Lineage for d1eiwa_ (1eiw A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311226Superfamily c.23.3: Hypothetical protein MTH538 [52206] (1 family) (S)
  5. 311227Family c.23.3.1: Hypothetical protein MTH538 [52207] (1 protein)
  6. 311228Protein Hypothetical protein MTH538 [52208] (1 species)
  7. 311229Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [52209] (1 PDB entry)
  8. 311230Domain d1eiwa_: 1eiw A: [31130]
    structural genomics

Details for d1eiwa_

PDB Entry: 1eiw (more details)

PDB Description: solution structure of hypothetical protein mth538 from methanobacterium thermoautotrophicum

SCOP Domain Sequences for d1eiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiwa_ c.23.3.1 (A:) Hypothetical protein MTH538 {Archaeon Methanobacterium thermoautotrophicum}
vtaeirlyitegevedyrvflerleqsglewrpatpedadavivlaglwgtrrdeilgav
dlarksskpiitvrpyglenvppeleavssevvgwnphcirdaledaldvi

SCOP Domain Coordinates for d1eiwa_:

Click to download the PDB-style file with coordinates for d1eiwa_.
(The format of our PDB-style files is described here.)

Timeline for d1eiwa_: