Lineage for d1eiwa_ (1eiw A:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.3: Hypothetical protein MTH538 [52206] (1 family) 
Family c.23.3.1: Hypothetical protein MTH538 [52207] (1 protein) Protein Hypothetical protein MTH538 [52208] (1 species) Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [52209] (1 PDB entry) 
Domain d1eiwa_: 1eiw A: [31130]
structural genomics protein
Details for d1eiwa_
PDB Entry: 1eiw (more details)
PDB Description: solution structure of hypothetical protein mth538 from methanobacterium thermoautotrophicum
SCOP Domain Sequences for d1eiwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiwa_ c.23.3.1 (A:) Hypothetical protein MTH538 {Archaeon Methanobacterium thermoautotrophicum}
vtaeirlyitegevedyrvflerleqsglewrpatpedadavivlaglwgtrrdeilgav
dlarksskpiitvrpyglenvppeleavssevvgwnphcirdaledaldvi
SCOP Domain Coordinates for d1eiwa_:
Click to download the PDB-style file with coordinates for d1eiwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eiwa_:
- d1eiwa_ first appeared (with stable ids) in SCOP 1.55
- d1eiwa_ appears in SCOP 1.61
- d1eiwa_ appears in SCOP 1.65
- d1eiwa_ appears in the current release, SCOPe 2.08
View in 3D