SCOPe 2.08: Domain d3tmya_: 3tmy A:

Lineage for d3tmya_ (3tmy A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (6 species)

7. Species Thermotoga maritima [TaxId:2336] [52177] (5 PDB entries)
   Uniprot Q56312

8. Domain d3tmya_: 3tmy A: [31084]
   complexed with mn

Details for d3tmya_

PDB Entry: 3tmy, 2.2 Å

PDB Description: chey from thermotoga maritima (mn-iii)

PDB Compounds: (A:) chey protein

SCOPe Domain Sequences for d3tmya_:

Sequence; same for both SEQRES and ATOM records:

>d3tmya_ c.23.1.1 (A:) CheY protein {Thermotoga maritima [TaxId: 2336]}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

Timeline for d3tmya_:

• d3tmya_ first appeared (with stable ids) in SCOP 1.55
  
• d3tmya_ appears in SCOPe 2.07