Lineage for d5e8gd_ (5e8g D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693426Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2693472Protein automated matches [191121] (2 species)
    not a true protein
  7. 2693473Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries)
  8. 2693490Domain d5e8gd_: 5e8g D: [310487]
    automated match to d1flia_
    complexed with co

Details for d5e8gd_

PDB Entry: 5e8g (more details), 2.7 Å

PDB Description: crystal structure of the dna binding domain of human transcription factor fli1
PDB Compounds: (D:) Friend leukemia integration 1 transcription factor

SCOPe Domain Sequences for d5e8gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e8gd_ a.4.5.21 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydklsra
lryyydknimtkvhgkryaykfdfhgiaqalqp

SCOPe Domain Coordinates for d5e8gd_:

Click to download the PDB-style file with coordinates for d5e8gd_.
(The format of our PDB-style files is described here.)

Timeline for d5e8gd_: