SCOPe 2.04: Domain d1ymva_: 1ymv A:

Lineage for d1ymva_ (1ymv A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d1ymva_: 1ymv A: [31045]
   complexed with mg; mutant

Details for d1ymva_

PDB Entry: 1ymv, 1.9 Å

PDB Description: signal transduction protein chey mutant with phe 14 replaced by gly, ser 15 replaced by gly, and met 17 replaced by gly

PDB Compounds: (A:) chey

SCOPe Domain Sequences for d1ymva_:

Sequence; same for both SEQRES and ATOM records:

>d1ymva_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
lkflvvddggtgrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmdg
lellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnkife
klgm

Timeline for d1ymva_:

• d1ymva_ first appeared (with stable ids) in SCOP 1.55, called d1ymv__
  
• d1ymva_ appears in SCOPe 2.03
  
• d1ymva_ appears in SCOPe 2.05
  
• d1ymva_ appears in the current release, SCOPe 2.08