Lineage for d1ymv__ (1ymv -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) Species Escherichia coli [TaxId:562] [52175] (24 PDB entries) 
Domain d1ymv__: 1ymv - [31045]
Details for d1ymv__
PDB Entry: 1ymv (more details), 1.9 Å
PDB Description: signal transduction protein chey mutant with phe 14 replaced by gly, ser 15 replaced by gly, and met 17 replaced by gly
SCOP Domain Sequences for d1ymv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ymv__ c.23.1.1 (-) CheY protein {Escherichia coli}
lkflvvddggtgrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmdg
lellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnkife
klgm
SCOP Domain Coordinates for d1ymv__:
Click to download the PDB-style file with coordinates for d1ymv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ymv__:
- d1ymv__ appears in SCOP 1.57
- d1ymv__ appears in the current release, SCOPe 2.08, called d1ymva_
View in 3D