Lineage for d4euga_ (4eug A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 981872Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 981873Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (4 families) (S)
  5. 981874Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 981875Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 981882Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 981884Domain d4euga_: 4eug A: [31019]
    protein/DNA complex; mutant

Details for d4euga_

PDB Entry: 4eug (more details), 1.4 Å

PDB Description: crystallographic and enzymatic studies of an active site variant h187q of escherichia coli uracil dna glycosylase: crystal structures of mutant h187q and its uracil complex
PDB Compounds: (A:) protein (glycosylase)

SCOPe Domain Sequences for d4euga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
apqpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

SCOPe Domain Coordinates for d4euga_:

Click to download the PDB-style file with coordinates for d4euga_.
(The format of our PDB-style files is described here.)

Timeline for d4euga_: